| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
| Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
| Protein automated matches [191055] (20 species) not a true protein |
| Species Xanthomonas oryzae [TaxId:64187] [188927] (16 PDB entries) |
| Domain d5cpda_: 5cpd A: [320295] automated match to d3dlda_ complexed with act, ala, cd, gol, met, na |
PDB Entry: 5cpd (more details), 2.2 Å
SCOPe Domain Sequences for d5cpda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cpda_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvls
Timeline for d5cpda_: