Lineage for d5cpda_ (5cpd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001238Species Xanthomonas oryzae [TaxId:64187] [188927] (16 PDB entries)
  8. 3001246Domain d5cpda_: 5cpd A: [320295]
    automated match to d3dlda_
    complexed with act, ala, cd, gol, met, na

Details for d5cpda_

PDB Entry: 5cpd (more details), 2.2 Å

PDB Description: methionine-alanine complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5cpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cpda_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvls

SCOPe Domain Coordinates for d5cpda_:

Click to download the PDB-style file with coordinates for d5cpda_.
(The format of our PDB-style files is described here.)

Timeline for d5cpda_: