Lineage for d5b33c_ (5b33 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699233Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 2699234Protein automated matches [238450] (4 species)
    not a true protein
  7. 2699238Species Human (Homo sapiens) [TaxId:9606] [238452] (8 PDB entries)
  8. 2699257Domain d5b33c_: 5b33 C: [320292]
    Other proteins in same PDB: d5b33a_, d5b33b_, d5b33d_, d5b33e_, d5b33f_, d5b33h_
    automated match to d1id3c_
    protein/DNA complex

Details for d5b33c_

PDB Entry: 5b33 (more details), 2.93 Å

PDB Description: the crystal structure of the h2az nucleosome with h3.3.
PDB Compounds: (C:) histone h2a.z

SCOPe Domain Sequences for d5b33c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b33c_ a.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
lkvkritprhlqlairgdeeldslikatiagggviphihksligk

SCOPe Domain Coordinates for d5b33c_:

Click to download the PDB-style file with coordinates for d5b33c_.
(The format of our PDB-style files is described here.)

Timeline for d5b33c_: