| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
| Domain d5b32a_: 5b32 A: [320291] Other proteins in same PDB: d5b32b_, d5b32f_, d5b32g_ automated match to d1eqzg_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5b32 (more details), 2.35 Å
SCOPe Domain Sequences for d5b32a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b32a_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirger
Timeline for d5b32a_: