Lineage for d3ranb_ (3ran B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475783Protein Ran [52609] (2 species)
  7. 2475784Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
    Uniprot P62825
  8. 2475789Domain d3ranb_: 3ran B: [32029]
    complexed with gdp, mg; mutant

Details for d3ranb_

PDB Entry: 3ran (more details), 2.15 Å

PDB Description: canine gdp-ran q69l mutant
PDB Compounds: (B:) protein (GTP-binding nuclear protein ran)

SCOPe Domain Sequences for d3ranb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ranb_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
ppevvmdpalaaqyehdlevaqtt

SCOPe Domain Coordinates for d3ranb_:

Click to download the PDB-style file with coordinates for d3ranb_.
(The format of our PDB-style files is described here.)

Timeline for d3ranb_: