Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Elastase [50536] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [50537] (12 PDB entries) |
Domain d5a8ya_: 5a8y A: [320278] automated match to d1ppfe_ complexed with 5ax, mes, mli, vbm |
PDB Entry: 5a8y (more details), 1.9 Å
SCOPe Domain Sequences for d5a8ya_:
Sequence, based on SEQRES records: (download)
>d5a8ya_ b.47.1.2 (A:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn glihgiasfvrggcasglypdafapvaqfvnwidsiiq
>d5a8ya_ b.47.1.2 (A:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcngl ihgiasfvrggcasglypdafapvaqfvnwidsiiq
Timeline for d5a8ya_: