![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces avermitilis [TaxId:227882] [260823] (3 PDB entries) |
![]() | Domain d5cweb_: 5cwe B: [320274] automated match to d4b7sa_ complexed with dao, gol, hem, so4 |
PDB Entry: 5cwe (more details), 2.39 Å
SCOPe Domain Sequences for d5cweb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cweb_ a.104.1.0 (B:) automated matches {Streptomyces avermitilis [TaxId: 227882]} mgnvidlgeygarftedpypvyaelrergpvhwvrtpppeafegwlvvgheearaaladp rlskdgtkkgltsldvelmgpyllvvdppehtrlrslvaraftmrrvealrpriqeitdg lldemlprgradlvdsfayplpitvicellgvpdidrvtfralsneivaptggdaelaay erlaayldeliddkrstapaddllgdlirtraedddrlsgeelramafillvaghettvn litngvhtllthpdqlaalradmtlldgaveevlrfegpvetatyryaaesmeiggtaia egdpvmigldaagrdparhpdphvfdihrapqghlafghgihyclgaplarlearvalrs llercpdlaldgppgarppgmlirgvrrlpvrw
Timeline for d5cweb_: