SCOPe 2.07: Domain d1g17b_: 1g17 B:

Lineage for d1g17b_ (1g17 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-related protein Sec4 [52607] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (3 PDB entries)

8. Domain d1g17b_: 1g17 B: [32027]
   complexed with gnp, mg

Details for d1g17b_

PDB Entry: 1g17, 2 Å

PDB Description: crystal structure of sec4-guanosine-5'-(beta,gamma)-imidotriphosphate

PDB Compounds: (B:) Ras-related protein SEC4

SCOPe Domain Sequences for d1g17b_:

Sequence; same for both SEQRES and ATOM records:

>d1g17b_ c.37.1.8 (B:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekids

Timeline for d1g17b_:

• d1g17b_ first appeared (with stable ids) in SCOP 1.55
  
• d1g17b_ appears in SCOPe 2.06
  
• d1g17b_ appears in the current release, SCOPe 2.08