Lineage for d1g17b_ (1g17 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988154Protein Rab-related protein Sec4 [52607] (1 species)
  7. 988155Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (4 PDB entries)
  8. 988161Domain d1g17b_: 1g17 B: [32027]
    complexed with gnp, mg

Details for d1g17b_

PDB Entry: 1g17 (more details), 2 Å

PDB Description: crystal structure of sec4-guanosine-5'-(beta,gamma)-imidotriphosphate
PDB Compounds: (B:) Ras-related protein SEC4

SCOPe Domain Sequences for d1g17b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g17b_ c.37.1.8 (B:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekids

SCOPe Domain Coordinates for d1g17b_:

Click to download the PDB-style file with coordinates for d1g17b_.
(The format of our PDB-style files is described here.)

Timeline for d1g17b_: