Lineage for d5aa6f_ (5aa6 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332425Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2332426Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2332472Family a.111.1.0: automated matches [320241] (1 protein)
    not a true family
  6. 2332473Protein automated matches [320242] (1 species)
    not a true protein
  7. 2332474Species Ascophyllum nodosum [TaxId:52969] [320243] (1 PDB entry)
  8. 2332480Domain d5aa6f_: 5aa6 F: [320244]
    automated match to d1qi9a_
    complexed with vo4

Details for d5aa6f_

PDB Entry: 5aa6 (more details), 2.26 Å

PDB Description: homohexameric structure of the second vanadate-dependent bromoperoxidase (anii) from ascophyllum nodosum
PDB Compounds: (F:) vanadium-dependent bromoperoxidase 2

SCOPe Domain Sequences for d5aa6f_:

Sequence, based on SEQRES records: (download)

>d5aa6f_ a.111.1.0 (F:) automated matches {Ascophyllum nodosum [TaxId: 52969]}
qtvneladmqtrpllsgsvcrvrdtvdflsptkrakitfkrrigiavgelavgptchlnn
gdeaniplfdgqfhkslphddmgrvnpeayqllldciesndinvcdqvpsgvesdgrklv
nplgggghqvdgadsdnifikqpdnllserlaaqqaevywmallrdipfsqfgtnntvqm
avvnlqgfdafnglsisrdadgnidpmqdlfrtdwpgvssgpmvsqfmlanfdidgivve
pkaktlvpemeymtgvdtwlniqnggppedtlfvdeplfirngrdlaalsfndvlyteaf
rtilimfnesilaeagpygsstrqegfttlgtshyihamaagssstrhawyakwqvhrvl
rpeayggllhfvinnliddvplpasivsntellnaveslnqaqnggtnqvfllpmavgeg
spvhpaypsghainlgayltvlkaflgfelgqrcfpspmisndagtdripfvpsdgdrvg
tcinedgeeevgltyegelnkvtsnvaigrshlgvhwrmdgvfgaemgeagairrlqqel
gglpeardtegpippasykfrlysgtmielfpdnrymlgdqmckgfftgddfcvpa

Sequence, based on observed residues (ATOM records): (download)

>d5aa6f_ a.111.1.0 (F:) automated matches {Ascophyllum nodosum [TaxId: 52969]}
qtvneladmqtrpllsgsvcrvrdtvdflsptkrakitfkrrigiavgelavgptchlnn
gdeaniplfdgqfhkslphddmgrvnpeayqllldciesndinvcdqvpsgvesdgrklv
nplgggghqvdgadsdnifikqpdnllserlaaqqaevywmallrdipfsqfgtnntvqm
avvnlqgfdafnglsisrdadgnidpmqdlfrtdwpgvssgpmvsqfmlanfdidgivve
pkaktlvpemeymtgvdtwlniqnggppedtlfvdeplfirngrdlaalsfndvlyteaf
rtilimfnesilaeagpygsstrqegfttlgtshyihamaagssstrhawyakwqvhrvl
rpeayggllhfviniddvplpasivsntellnaveslnqaqnggtnqvfllpmavgegsp
vhpaypsghainlgayltvlkaflgfelgqrcfpspmisndagtdripfvpsdgdrvgtc
inedgeeevgltyegelnkvtsnvaigrshlgvhwrmdgvfgaemgeagairrlqqelgg
lpeardtegpippasykfrlysgtmielfpdnrymlgdqmckgfftgddfcvpa

SCOPe Domain Coordinates for d5aa6f_:

Click to download the PDB-style file with coordinates for d5aa6f_.
(The format of our PDB-style files is described here.)

Timeline for d5aa6f_: