Lineage for d1g16c_ (1g16 C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Rab-related protein Sec4 [52607] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (2 PDB entries) 
Domain d1g16c_: 1g16 C: [32024]
Details for d1g16c_
PDB Entry: 1g16 (more details), 1.8 Å
PDB Description: crystal structure of sec4-gdp
SCOP Domain Sequences for d1g16c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g16c_ c.37.1.8 (C:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae)}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekid
SCOP Domain Coordinates for d1g16c_:
Click to download the PDB-style file with coordinates for d1g16c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g16c_:
- d1g16c_ appears in SCOP 1.57
- d1g16c_ appears in the current release, SCOPe 2.08
View in 3D
