Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab-related protein Sec4 [52607] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (3 PDB entries) |
Domain d1g16c_: 1g16 C: [32024] complexed with co, gdp |
PDB Entry: 1g16 (more details), 1.8 Å
SCOPe Domain Sequences for d1g16c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g16c_ c.37.1.8 (C:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme trvvtadqgealakelgipfiessaknddnvneifftlakliqekid
Timeline for d1g16c_: