![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
![]() | Domain d4zolf2: 4zol F:77-378 [320237] Other proteins in same PDB: d4zola1, d4zola2, d4zolb1, d4zolb2, d4zolc1, d4zolc2, d4zold1, d4zold2, d4zole_, d4zolf1, d4zolf3 automated match to d3tiia2 complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zol (more details), 2.5 Å
SCOPe Domain Sequences for d4zolf2:
Sequence, based on SEQRES records: (download)
>d4zolf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4zolf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptntderevflaaynrrregregnvwiaksgilis seaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrt ssepynsanfqdktchltnhciqkeynygryeegnemffeefnqylmdalnttlensill qikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyae lcqgivdvaissvfpladttsifikl
Timeline for d4zolf2: