Lineage for d4zolf1 (4zol F:1-76)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470419Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2470420Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2470421Species Chicken (Gallus gallus) [TaxId:9031] [311384] (170 PDB entries)
  8. 2470562Domain d4zolf1: 4zol F:1-76 [320236]
    Other proteins in same PDB: d4zola1, d4zola2, d4zolb1, d4zolb2, d4zolc1, d4zolc2, d4zold1, d4zold2, d4zole_, d4zolf2, d4zolf3
    automated match to d3tiia1
    complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zolf1

PDB Entry: 4zol (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4zolf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zolf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d4zolf1:

Click to download the PDB-style file with coordinates for d4zolf1.
(The format of our PDB-style files is described here.)

Timeline for d4zolf1: