Lineage for d5hxve_ (5hxv E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780318Species Talaromyces cellulolyticus [TaxId:87693] [320037] (1 PDB entry)
  8. 2780323Domain d5hxve_: 5hxv E: [320234]
    automated match to d3wp3a_
    mutant

Details for d5hxve_

PDB Entry: 5hxv (more details), 2 Å

PDB Description: the crystal structure of thermostable xylanase mutant
PDB Compounds: (E:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d5hxve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hxve_ b.29.1.11 (E:) automated matches {Talaromyces cellulolyticus [TaxId: 87693]}
cittsqtgthngyyysfwtngggevtmclgpggeysvtwvncgdftsgkgwnpanaqtvt
ysgefnpngnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiystq
rvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegyes
sgsstitvs

SCOPe Domain Coordinates for d5hxve_:

Click to download the PDB-style file with coordinates for d5hxve_.
(The format of our PDB-style files is described here.)

Timeline for d5hxve_: