Lineage for d4zhqb2 (4zhq B:246-438)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525500Protein Tubulin beta-subunit [55313] (2 species)
  7. 2525512Species Pig (Sus scrofa) [TaxId:9823] [55314] (8 PDB entries)
  8. 2525521Domain d4zhqb2: 4zhq B:246-438 [320231]
    Other proteins in same PDB: d4zhqa1, d4zhqa2, d4zhqb1, d4zhqc1, d4zhqc2, d4zhqd1, d4zhqe_, d4zhqf1, d4zhqf2, d4zhqf3
    automated match to d1sa0b2
    complexed with 4q5, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zhqb2

PDB Entry: 4zhq (more details), 2.55 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-mmae complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4zhqb2:

Sequence, based on SEQRES records: (download)

>d4zhqb2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d4zhqb2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrsqqyraltvpeltqqmfdaknmmaacd
prhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms
atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
yqda

SCOPe Domain Coordinates for d4zhqb2:

Click to download the PDB-style file with coordinates for d4zhqb2.
(The format of our PDB-style files is described here.)

Timeline for d4zhqb2: