Lineage for d4zhqb1 (4zhq B:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445256Protein Tubulin beta-subunit [52496] (2 species)
  7. 2445269Species Pig (Sus scrofa) [TaxId:9823] [52497] (8 PDB entries)
  8. 2445278Domain d4zhqb1: 4zhq B:1-245 [320230]
    Other proteins in same PDB: d4zhqa1, d4zhqa2, d4zhqb2, d4zhqc1, d4zhqc2, d4zhqd2, d4zhqe_, d4zhqf1, d4zhqf2, d4zhqf3
    automated match to d1sa0b1
    complexed with 4q5, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zhqb1

PDB Entry: 4zhq (more details), 2.55 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-mmae complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4zhqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhqb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d4zhqb1:

Click to download the PDB-style file with coordinates for d4zhqb1.
(The format of our PDB-style files is described here.)

Timeline for d4zhqb1: