Lineage for d4zhqc1 (4zhq C:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445466Species Pig (Sus scrofa) [TaxId:9823] [278808] (23 PDB entries)
  8. 2445488Domain d4zhqc1: 4zhq C:1-245 [320227]
    Other proteins in same PDB: d4zhqa2, d4zhqb1, d4zhqb2, d4zhqc2, d4zhqd1, d4zhqd2, d4zhqe_, d4zhqf1, d4zhqf2, d4zhqf3
    automated match to d4ihja1
    complexed with 4q5, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zhqc1

PDB Entry: 4zhq (more details), 2.55 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-mmae complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4zhqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhqc1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d4zhqc1:

Click to download the PDB-style file with coordinates for d4zhqc1.
(The format of our PDB-style files is described here.)

Timeline for d4zhqc1: