SCOPe 2.07: Domain d4zole_: 4zol E:

Lineage for d4zole_ (4zol E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)

8. Domain d4zole_: 4zol E: [320221]
   Other proteins in same PDB: d4zola1, d4zola2, d4zolb1, d4zolb2, d4zolc1, d4zolc2, d4zold1, d4zold2, d4zolf1, d4zolf2, d4zolf3
   automated match to d4i55e_
   complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zole_

PDB Entry: 4zol, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4zole_:

Sequence, based on SEQRES records:

>d4zole_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d4zole_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsrdpsleeiqkkleaaeerrkyqeaellkhlaekrehe
reviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkel
ke

Timeline for d4zole_:

• d4zole_ first appeared in SCOPe 2.06
  
• d4zole_ appears in the current release, SCOPe 2.08