Lineage for d1g16a_ (1g16 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 protein domains)
  6. 23248Protein Rab-related protein Sec4 [52607] (1 species)
  7. 23249Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (2 PDB entries)
  8. 23250Domain d1g16a_: 1g16 A: [32022]

Details for d1g16a_

PDB Entry: 1g16 (more details), 1.8 Å

PDB Description: crystal structure of sec4-gdp

SCOP Domain Sequences for d1g16a_:

Sequence, based on SEQRES records: (download)

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae)}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqeki

Sequence, based on observed residues (ATOM records): (download)

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae)}
simkilligdsgvgkscllvrfvedkfnpidfkiktvdingkkvklqiwdtagqerfrti
ttayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdmetrvvtad
qgealakelgipfiessaknddnvneifftlakliqeki

SCOP Domain Coordinates for d1g16a_:

Click to download the PDB-style file with coordinates for d1g16a_.
(The format of our PDB-style files is described here.)

Timeline for d1g16a_: