Lineage for d4zzla1 (4zzl A:5-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983395Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1983495Protein automated matches [190294] (6 species)
    not a true protein
  7. 1983509Species Pseudomonas aeruginosa [TaxId:287] [320186] (1 PDB entry)
  8. 1983510Domain d4zzla1: 4zzl A:5-139 [320217]
    Other proteins in same PDB: d4zzla2
    automated match to d1lnwa_
    complexed with gol; mutant

Details for d4zzla1

PDB Entry: 4zzl (more details), 2.19 Å

PDB Description: mexr r21w derepressor mutant causing multidrug resistance in p. aeruginosa by mexab-oprm efflux pump expression
PDB Compounds: (A:) Multidrug resistance operon repressor

SCOPe Domain Sequences for d4zzla1:

Sequence, based on SEQRES records: (download)

>d4zzla1 a.4.5.28 (A:5-139) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vnpdlmpalmavfqhvwtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmcrd
kalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfaplt
pveqatlvhlldqcl

Sequence, based on observed residues (ATOM records): (download)

>d4zzla1 a.4.5.28 (A:5-139) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vnpdlmpalmavfqhvwtriqseldldltppdvhvlklideqrglnlqdlgrqmcrdkal
itrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfapltpve
qatlvhlldqcl

SCOPe Domain Coordinates for d4zzla1:

Click to download the PDB-style file with coordinates for d4zzla1.
(The format of our PDB-style files is described here.)

Timeline for d4zzla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zzla2
View in 3D
Domains from other chains:
(mouse over for more information)
d4zzlb_