Lineage for d5hxvf_ (5hxv F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780318Species Talaromyces cellulolyticus [TaxId:87693] [320037] (1 PDB entry)
  8. 2780324Domain d5hxvf_: 5hxv F: [320209]
    automated match to d3wp3a_
    mutant

Details for d5hxvf_

PDB Entry: 5hxv (more details), 2 Å

PDB Description: the crystal structure of thermostable xylanase mutant
PDB Compounds: (F:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d5hxvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hxvf_ b.29.1.11 (F:) automated matches {Talaromyces cellulolyticus [TaxId: 87693]}
cittsqtgthngyyysfwtngggevtmclgpggeysvtwvncgdftsgkgwnpanaqtvt
ysgefnpngnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiystq
rvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegyes
sgsstitvs

SCOPe Domain Coordinates for d5hxvf_:

Click to download the PDB-style file with coordinates for d5hxvf_.
(The format of our PDB-style files is described here.)

Timeline for d5hxvf_: