Lineage for d5i9ed2 (5i9e D:147-375)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491508Species Saccharomyces bayanus [TaxId:4931] [320047] (1 PDB entry)
  8. 2491512Domain d5i9ed2: 5i9e D:147-375 [320207]
    automated match to d1yaga2
    complexed with atp, mg

Details for d5i9ed2

PDB Entry: 5i9e (more details), 2.8 Å

PDB Description: crystal structure of a nuclear actin ternary complex
PDB Compounds: (D:) actin

SCOPe Domain Sequences for d5i9ed2:

Sequence, based on SEQRES records: (download)

>d5i9ed2 c.55.1.1 (D:147-375) Actin {Saccharomyces bayanus [TaxId: 4931]}
rttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkcf

Sequence, based on observed residues (ATOM records): (download)

>d5i9ed2 c.55.1.1 (D:147-375) Actin {Saccharomyces bayanus [TaxId: 4931]}
rttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilseraereivrdik
eklcyvaldfeqemqtaaqsssiekgnerfrapealfhpsvlglesagidqttynsimkc
dvdvrkelygnivmsggttmfpgiaermqkeitalapssmkvkiiapperkysvwiggsi
laslttfqqmwiskqeydesgpsivhhkcf

SCOPe Domain Coordinates for d5i9ed2:

Click to download the PDB-style file with coordinates for d5i9ed2.
(The format of our PDB-style files is described here.)

Timeline for d5i9ed2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i9ed1