Lineage for d4zolb1 (4zol B:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471520Protein Tubulin beta-subunit [52496] (2 species)
  7. 2471535Species Pig (Sus scrofa) [TaxId:9823] [52497] (8 PDB entries)
  8. 2471542Domain d4zolb1: 4zol B:1-245 [320195]
    Other proteins in same PDB: d4zola1, d4zola2, d4zolb2, d4zolc1, d4zolc2, d4zold2, d4zole_, d4zolf1, d4zolf2, d4zolf3
    automated match to d1sa0b1
    complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zolb1

PDB Entry: 4zol (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4zolb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zolb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d4zolb1:

Click to download the PDB-style file with coordinates for d4zolb1.
(The format of our PDB-style files is described here.)

Timeline for d4zolb1: