Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
Protein automated matches [191143] (10 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [225479] (17 PDB entries) |
Domain d5hqxa1: 5hqx A:38-246 [320193] Other proteins in same PDB: d5hqxa2 automated match to d4o95a1 complexed with edz, fad |
PDB Entry: 5hqx (more details), 2.05 Å
SCOPe Domain Sequences for d5hqxa1:
Sequence, based on SEQRES records: (download)
>d5hqxa1 d.145.1.0 (A:38-246) automated matches {Maize (Zea mays) [TaxId: 4577]} vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg hghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwt lshgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcset enpdlffgvlgglgqfgiitrarialera
>d5hqxa1 d.145.1.0 (A:38-246) automated matches {Maize (Zea mays) [TaxId: 4577]} vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg hghsisgqaqaaggvvvdmsrgraralpvhsaalgghyvdvwggelwvdvlnwtlshggl aprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcsetenpdlf fgvlgglgqfgiitrarialera
Timeline for d5hqxa1: