SCOPe 2.06: Domain d5hqxa1: 5hqx A:38-246

Lineage for d5hqxa1 (5hqx A:38-246)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (10 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225479] (17 PDB entries)

8. Domain d5hqxa1: 5hqx A:38-246 [320193]
   Other proteins in same PDB: d5hqxa2
   automated match to d4o95a1
   complexed with edz, fad

Details for d5hqxa1

PDB Entry: 5hqx, 2.05 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor hetdz

PDB Compounds: (A:) Cytokinin dehydrogenase 4

SCOPe Domain Sequences for d5hqxa1:

Sequence, based on SEQRES records:

>d5hqxa1 d.145.1.0 (A:38-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg
hghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwt
lshgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcset
enpdlffgvlgglgqfgiitrarialera

Sequence, based on observed residues (ATOM records):

>d5hqxa1 d.145.1.0 (A:38-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg
hghsisgqaqaaggvvvdmsrgraralpvhsaalgghyvdvwggelwvdvlnwtlshggl
aprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcsetenpdlf
fgvlgglgqfgiitrarialera

Timeline for d5hqxa1:

• d5hqxa1 is new in SCOPe 2.06-stable
  
• d5hqxa1 appears in SCOPe 2.07
  
• d5hqxa1 appears in the current release, SCOPe 2.08