SCOPe 2.06: Domain d4zi7c1: 4zi7 C:1-245

Lineage for d4zi7c1 (4zi7 C:1-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (9 PDB entries)

8. Domain d4zi7c1: 4zi7 C:1-245 [320190]
   Other proteins in same PDB: d4zi7a2, d4zi7b1, d4zi7b2, d4zi7c2, d4zi7d1, d4zi7d2, d4zi7e_, d4zi7f1, d4zi7f2, d4zi7f3
   automated match to d4ihja1
   complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zi7c1

PDB Entry: 4zi7, 2.51 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-hti286 complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4zi7c1:

Sequence; same for both SEQRES and ATOM records:

>d4zi7c1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d4zi7c1:

• d4zi7c1 is new in SCOPe 2.06-stable
  
• d4zi7c1 appears in SCOPe 2.07
  
• d4zi7c1 appears in the current release, SCOPe 2.08