SCOPe 2.05: Domain d1zbda_: 1zbd A:

Lineage for d1zbda_ (1zbd A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab3a [52601] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52602] (2 PDB entries)

8. Domain d1zbda_: 1zbd A: [32019]
   Other proteins in same PDB: d1zbdb_
   complexed with gtp, mg, zn

Details for d1zbda_

PDB Entry: 1zbd, 2.6 Å

PDB Description: structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a

PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d1zbda_:

Sequence; same for both SEQRES and ATOM records:

>d1zbda_ c.37.1.8 (A:) Rab3a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
shmfdymfkiliignssvgktsflfryaddsftpafvstvgidfkvktiyrndkriklqi
wdtagleryrtittayyrgamgfilmyditneesfnavqdwstqiktyswdnaqvllvgn
kcdmedervvssergrqladhlgfeffeasakdninvkqtferlvdvicekmsesld

Timeline for d1zbda_:

• d1zbda_ first appeared (with stable ids) in SCOP 1.55
  
• d1zbda_ appears in SCOPe 2.04
  
• d1zbda_ appears in SCOPe 2.06
  
• d1zbda_ appears in the current release, SCOPe 2.08