Lineage for d1zbda_ (1zbd A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Rab3a [52601] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52602] (2 PDB entries) 
Domain d1zbda_: 1zbd A: [32019]
Other proteins in same PDB: d1zbdb_
Details for d1zbda_
PDB Entry: 1zbd (more details), 2.6 Å
PDB Description: structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
SCOP Domain Sequences for d1zbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbda_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus)}
shmfdymfkiliignssvgktsflfryaddsftpafvstvgidfkvktiyrndkriklqi
wdtagleryrtittayyrgamgfilmyditneesfnavqdwstqiktyswdnaqvllvgn
kcdmedervvssergrqladhlgfeffeasakdninvkqtferlvdvicekmsesld
SCOP Domain Coordinates for d1zbda_:
Click to download the PDB-style file with coordinates for d1zbda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zbda_:
- d1zbda_ appears in SCOP 1.57
- d1zbda_ appears in the current release, SCOPe 2.08
View in 3D
