| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
| Domain d4zolc2: 4zol C:246-440 [320185] Other proteins in same PDB: d4zola1, d4zolb1, d4zolb2, d4zolc1, d4zold1, d4zold2, d4zole_, d4zolf1, d4zolf2, d4zolf3 automated match to d4i50a2 complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zol (more details), 2.5 Å
SCOPe Domain Sequences for d4zolc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zolc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv
Timeline for d4zolc2: