Lineage for d4zolc2 (4zol C:246-440)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566521Domain d4zolc2: 4zol C:246-440 [320185]
    Other proteins in same PDB: d4zola1, d4zolb1, d4zolb2, d4zolc1, d4zold1, d4zold2, d4zole_, d4zolf1, d4zolf2, d4zolf3
    automated match to d4i50a2
    complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zolc2

PDB Entry: 4zol (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-tubulysin m complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4zolc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zolc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d4zolc2:

Click to download the PDB-style file with coordinates for d4zolc2.
(The format of our PDB-style files is described here.)

Timeline for d4zolc2: