![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (10 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries) |
![]() | Domain d4zolc1: 4zol C:1-245 [320184] Other proteins in same PDB: d4zola2, d4zolb1, d4zolb2, d4zolc2, d4zold1, d4zold2, d4zole_, d4zolf1, d4zolf2, d4zolf3 automated match to d4ihja1 complexed with 55q, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zol (more details), 2.5 Å
SCOPe Domain Sequences for d4zolc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zolc1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d4zolc1: