Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab3a [52601] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52602] (2 PDB entries) |
Domain d3raba_: 3rab A: [32018] complexed with gnp, mg |
PDB Entry: 3rab (more details), 2 Å
SCOPe Domain Sequences for d3raba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3raba_ c.37.1.8 (A:) Rab3a {Norway rat (Rattus norvegicus) [TaxId: 10116]} nfdymfkiliignssvgktsflfryaddsftpafvstvgidfkvktiyrndkriklqiwd tagqeryrtittayyrgamgfilmyditneesfnavqdwstqiktyswdnaqvllvgnkc dmedervvssergrqladhlgfeffeasakdninvkqtferlvdvicek
Timeline for d3raba_: