Lineage for d3raba_ (3rab A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846537Protein Rab3a [52601] (1 species)
  7. 1846538Species Norway rat (Rattus norvegicus) [TaxId:10116] [52602] (2 PDB entries)
  8. 1846539Domain d3raba_: 3rab A: [32018]
    complexed with gnp, mg

Details for d3raba_

PDB Entry: 3rab (more details), 2 Å

PDB Description: gppnhp-bound rab3a at 2.0 a resolution
PDB Compounds: (A:) protein (rab3a)

SCOPe Domain Sequences for d3raba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3raba_ c.37.1.8 (A:) Rab3a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfdymfkiliignssvgktsflfryaddsftpafvstvgidfkvktiyrndkriklqiwd
tagqeryrtittayyrgamgfilmyditneesfnavqdwstqiktyswdnaqvllvgnkc
dmedervvssergrqladhlgfeffeasakdninvkqtferlvdvicek

SCOPe Domain Coordinates for d3raba_:

Click to download the PDB-style file with coordinates for d3raba_.
(The format of our PDB-style files is described here.)

Timeline for d3raba_: