SCOPe 2.01: Domain d3raba_: 3rab A:

Lineage for d3raba_ (3rab A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab3a [52601] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52602] (2 PDB entries)

8. Domain d3raba_: 3rab A: [32018]
   complexed with gnp, mg

Details for d3raba_

PDB Entry: 3rab, 2 Å

PDB Description: gppnhp-bound rab3a at 2.0 a resolution

PDB Compounds: (A:) protein (rab3a)

SCOPe Domain Sequences for d3raba_:

Sequence; same for both SEQRES and ATOM records:

>d3raba_ c.37.1.8 (A:) Rab3a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfdymfkiliignssvgktsflfryaddsftpafvstvgidfkvktiyrndkriklqiwd
tagqeryrtittayyrgamgfilmyditneesfnavqdwstqiktyswdnaqvllvgnkc
dmedervvssergrqladhlgfeffeasakdninvkqtferlvdvicek

Timeline for d3raba_:

• d3raba_ first appeared (with stable ids) in SCOP 1.55
  
• d3raba_ appears in SCOP 1.75
  
• d3raba_ appears in SCOPe 2.02
  
• d3raba_ appears in the current release, SCOPe 2.08