SCOPe 2.07: Domain d4zi7f1: 4zi7 F:1-76

Lineage for d4zi7f1 (4zi7 F:1-76)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (170 PDB entries)

8. Domain d4zi7f1: 4zi7 F:1-76 [320174]
   Other proteins in same PDB: d4zi7a1, d4zi7a2, d4zi7b1, d4zi7b2, d4zi7c1, d4zi7c2, d4zi7d1, d4zi7d2, d4zi7e_, d4zi7f2, d4zi7f3
   automated match to d3tiia1
   complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zi7f1

PDB Entry: 4zi7, 2.51 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-hti286 complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4zi7f1:

Sequence; same for both SEQRES and ATOM records:

>d4zi7f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d4zi7f1:

• d4zi7f1 first appeared in SCOPe 2.06
  
• d4zi7f1 appears in the current release, SCOPe 2.08