Lineage for d2rapa_ (2rap A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867757Protein Rap2a [52599] (1 species)
  7. 2867758Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries)
  8. 2867760Domain d2rapa_: 2rap A: [32017]
    complexed with gtp, mg

Details for d2rapa_

PDB Entry: 2rap (more details), 2.6 Å

PDB Description: the small g protein rap2a in complex with gtp
PDB Compounds: (A:) rap2a

SCOPe Domain Sequences for d2rapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rapa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya

SCOPe Domain Coordinates for d2rapa_:

Click to download the PDB-style file with coordinates for d2rapa_.
(The format of our PDB-style files is described here.)

Timeline for d2rapa_: