Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (43 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rap2a [52599] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries) |
Domain d3raps_: 3rap S: [32016] |
PDB Entry: 3rap (more details), 2.2 Å
SCOP Domain Sequences for d3raps_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3raps_ c.37.1.8 (S:) Rap2a {Human (Homo sapiens)} mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya
Timeline for d3raps_: