![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
![]() | Protein automated matches [190873] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
![]() | Domain d5kc6c1: 5kc6 C:59-193 [320158] Other proteins in same PDB: d5kc6a2, d5kc6b2, d5kc6c2 automated match to d4qpyb_ complexed with nag; mutant |
PDB Entry: 5kc6 (more details), 2.8 Å
SCOPe Domain Sequences for d5kc6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kc6c1 b.22.1.0 (C:59-193) automated matches {Human (Homo sapiens) [TaxId: 9606]} sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg gwkystfsgflvfpl
Timeline for d5kc6c1:
![]() Domains from other chains: (mouse over for more information) d5kc6a1, d5kc6a2, d5kc6b1, d5kc6b2 |