SCOP 1.71: Domain d3rapr_: 3rap R:

Lineage for d3rapr_ (3rap R:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rap2a [52599] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries)

8. Domain d3rapr_: 3rap R: [32015]

Details for d3rapr_

PDB Entry: 3rap, 2.2 Å

PDB Description: the small g protein rap2 in a non catalytic complex with gtp

SCOP Domain Sequences for d3rapr_:

Sequence; same for both SEQRES and ATOM records:

>d3rapr_ c.37.1.8 (R:) Rap2a {Human (Homo sapiens)}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya

Timeline for d3rapr_:

• d3rapr_ first appeared (with stable ids) in SCOP 1.55
  
• d3rapr_ appears in SCOP 1.69
  
• d3rapr_ appears in SCOP 1.73
  
• d3rapr_ appears in the current release, SCOPe 2.08