Lineage for d1kao__ (1kao -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Rap2a [52599] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries) 
Domain d1kao__: 1kao - [32014]
Details for d1kao__
PDB Entry: 1kao (more details), 1.7 Å
PDB Description: crystal structure of the small g protein rap2a with gdp
SCOP Domain Sequences for d1kao__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kao__ c.37.1.8 (-) Rap2a {Human (Homo sapiens)}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya
SCOP Domain Coordinates for d1kao__:
Click to download the PDB-style file with coordinates for d1kao__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kao__:
- d1kao__ appears in SCOP 1.57
- d1kao__ appears in the current release, SCOPe 2.08, called d1kaoa_
View in 3D