![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.0: automated matches [254238] (1 protein) not a true family |
![]() | Protein automated matches [254542] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255408] (6 PDB entries) |
![]() | Domain d2naqa_: 2naq A: [320134] automated match to d3qf2a_ |
PDB Entry: 2naq (more details)
SCOPe Domain Sequences for d2naqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2naqa_ a.77.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mastrcklaryledledvdlkkfkmhledyppqkgciplprgqtekadhvdlatlmidfn geekawamavwifaainrrdlyekakrdepk
Timeline for d2naqa_: