Lineage for d5ktna1 (5ktn A:1-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923617Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2923618Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2923619Family c.145.1.1: NadA-like [142755] (1 protein)
    Pfam PF02445
  6. 2923620Protein Quinolinate synthetase A, NadA [142756] (2 species)
  7. 2923623Species Pyrococcus horikoshii [TaxId:70601] [319156] (12 PDB entries)
  8. 2923626Domain d5ktna1: 5ktn A:1-300 [320132]
    Other proteins in same PDB: d5ktna2
    automated match to d1wzua1
    complexed with 13p, cl, nh4, sf4

Details for d5ktna1

PDB Entry: 5ktn (more details), 1.34 Å

PDB Description: crystal structure of pyrococcus horikoshii quinolinate synthase (nada) with bound dihydroxyacetone phosphate (dhap) and fe4s4 cluster
PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d5ktna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktna1 c.145.1.1 (A:1-300) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]}
mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk

SCOPe Domain Coordinates for d5ktna1:

Click to download the PDB-style file with coordinates for d5ktna1.
(The format of our PDB-style files is described here.)

Timeline for d5ktna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ktna2