SCOPe 2.05: Domain d1guaa_: 1gua A:

Lineage for d1guaa_ (1gua A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rap1A [52597] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52598] (2 PDB entries)

8. Domain d1guaa_: 1gua A: [32013]
   Other proteins in same PDB: d1guab_
   complexed with ca, gnp, mg; mutant

Details for d1guaa_

PDB Entry: 1gua, 2 Å

PDB Description: human rap1a, residues 1-167, double mutant (e30d,k31e) complexed with gppnhp and the ras-binding-domain of human c-raf1, residues 51-131

PDB Compounds: (A:) rap1a

SCOPe Domain Sequences for d1guaa_:

Sequence; same for both SEQRES and ATOM records:

>d1guaa_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvdeydptiedsyrkqvevdcqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdl
edervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

Timeline for d1guaa_:

• d1guaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1guaa_ appears in SCOPe 2.04
  
• d1guaa_ appears in SCOPe 2.06
  
• d1guaa_ appears in the current release, SCOPe 2.08