Lineage for d1guaa_ (1gua A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867753Protein Rap1A [52597] (1 species)
  7. 2867754Species Human (Homo sapiens) [TaxId:9606] [52598] (2 PDB entries)
  8. 2867756Domain d1guaa_: 1gua A: [32013]
    Other proteins in same PDB: d1guab_
    complexed with ca, gnp, mg; mutant

Details for d1guaa_

PDB Entry: 1gua (more details), 2 Å

PDB Description: human rap1a, residues 1-167, double mutant (e30d,k31e) complexed with gppnhp and the ras-binding-domain of human c-raf1, residues 51-131
PDB Compounds: (A:) rap1a

SCOPe Domain Sequences for d1guaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guaa_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvdeydptiedsyrkqvevdcqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdl
edervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

SCOPe Domain Coordinates for d1guaa_:

Click to download the PDB-style file with coordinates for d1guaa_.
(The format of our PDB-style files is described here.)

Timeline for d1guaa_: