Lineage for d5brcd1 (5brc D:2-152)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053448Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2053449Protein automated matches [190701] (11 species)
    not a true protein
  7. 2053535Species Diaphorobacter sp. [TaxId:1302548] [319937] (3 PDB entries)
  8. 2053541Domain d5brcd1: 5brc D:2-152 [320128]
    Other proteins in same PDB: d5brca2, d5brcc_, d5brcd2, d5brcf_, d5brcg2, d5brci_
    automated match to d1o7na1
    complexed with fe, fes

Details for d5brcd1

PDB Entry: 5brc (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (D:) 3NT oxygenase alpha subunit

SCOPe Domain Sequences for d5brcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brcd1 b.33.1.0 (D:2-152) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
ygdaikkkclglkevpriesfhgfiygcfda

SCOPe Domain Coordinates for d5brcd1:

Click to download the PDB-style file with coordinates for d5brcd1.
(The format of our PDB-style files is described here.)

Timeline for d5brcd1:

  • d5brcd1 is new in SCOPe 2.06-stable
  • d5brcd1 does not appear in SCOPe 2.07