SCOPe 2.06: Domain d5ktra1: 5ktr A:1-300

Lineage for d5ktra1 (5ktr A:1-300)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.145: NadA-like [142753] (1 superfamily)
   duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134

4. Superfamily c.145.1: NadA-like [142754] (2 families)
   automatically mapped to Pfam PF02445

5. Family c.145.1.1: NadA-like [142755] (1 protein)
   Pfam PF02445

6. Protein Quinolinate synthetase A, NadA [142756] (2 species)

7. Species Pyrococcus horikoshii [TaxId:70601] [319156] (8 PDB entries)

8. Domain d5ktra1: 5ktr A:1-300 [320125]
   Other proteins in same PDB: d5ktra2
   automated match to d1wzua1
   complexed with cl, mae, nh4, sf4

Details for d5ktra1

PDB Entry: 5ktr, 1.34 Å

PDB Description: crystal structure of pyrococcus horikoshii quinolinate synthase (nada) with bound maleate and fe4s4 cluster

PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d5ktra1:

Sequence; same for both SEQRES and ATOM records:

>d5ktra1 c.145.1.1 (A:1-300) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]}
mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk

Timeline for d5ktra1:

• d5ktra1 is new in SCOPe 2.06-stable
  
• d5ktra1 appears in SCOPe 2.07
  
• d5ktra1 appears in the current release, SCOPe 2.08