Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (35 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rap1A [52597] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52598] (2 PDB entries) |
Domain d1c1ya_: 1c1y A: [32012] Other proteins in same PDB: d1c1yb_ complexed with ca, gtp, mg |
PDB Entry: 1c1y (more details), 1.9 Å
SCOP Domain Sequences for d1c1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens)} mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildtag teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdl edervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr
Timeline for d1c1ya_: