| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
| Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
| Protein automated matches [191143] (12 species) not a true protein |
| Species Rhodococcus jostii [TaxId:101510] [319925] (4 PDB entries) |
| Domain d5fxpa1: 5fxp A:2-238 [320115] Other proteins in same PDB: d5fxpa2, d5fxpb2 automated match to d1e0ya2 complexed with fad, gol, v55 |
PDB Entry: 5fxp (more details), 2.6 Å
SCOPe Domain Sequences for d5fxpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fxpa1 d.145.1.0 (A:2-238) automated matches {Rhodococcus jostii [TaxId: 101510]}
trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrp
Timeline for d5fxpa1: