Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Talaromyces cellulolyticus [TaxId:87693] [320037] (1 PDB entry) |
Domain d5hxvb_: 5hxv B: [320108] automated match to d3wp3a_ mutant |
PDB Entry: 5hxv (more details), 2 Å
SCOPe Domain Sequences for d5hxvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hxvb_ b.29.1.11 (B:) automated matches {Talaromyces cellulolyticus [TaxId: 87693]} cittsqtgthngyyysfwtngggevtmclgpggeysvtwvncgdftsgkgwnpanaqtvt ysgefnpngnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiystq rvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegyes sgsstitvs
Timeline for d5hxvb_: