SCOPe 2.08: Domain d5kc6b1: 5kc6 B:59-193

Lineage for d5kc6b1 (5kc6 B:59-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)

8. Domain d5kc6b1: 5kc6 B:59-193 [320099]
   Other proteins in same PDB: d5kc6a2, d5kc6b2, d5kc6c2
   automated match to d4qpyb_
   complexed with nag; mutant

Details for d5kc6b1

PDB Entry: 5kc6, 2.8 Å

PDB Description: crystal structure of cbln1 (val55-gly58 deletion mutant)

PDB Compounds: (B:) Cerebellin-1

SCOPe Domain Sequences for d5kc6b1:

Sequence; same for both SEQRES and ATOM records:

>d5kc6b1 b.22.1.0 (B:59-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv
vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg
gwkystfsgflvfpl

Timeline for d5kc6b1:

• d5kc6b1 first appeared in SCOPe 2.06
  
• d5kc6b1 appears in SCOPe 2.07