Lineage for d5kc6b1 (5kc6 B:59-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777645Domain d5kc6b1: 5kc6 B:59-193 [320099]
    Other proteins in same PDB: d5kc6a2, d5kc6b2, d5kc6c2
    automated match to d4qpyb_
    complexed with nag; mutant

Details for d5kc6b1

PDB Entry: 5kc6 (more details), 2.8 Å

PDB Description: crystal structure of cbln1 (val55-gly58 deletion mutant)
PDB Compounds: (B:) Cerebellin-1

SCOPe Domain Sequences for d5kc6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kc6b1 b.22.1.0 (B:59-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv
vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg
gwkystfsgflvfpl

SCOPe Domain Coordinates for d5kc6b1:

Click to download the PDB-style file with coordinates for d5kc6b1.
(The format of our PDB-style files is described here.)

Timeline for d5kc6b1: