Lineage for d5hmra1 (5hmr A:40-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223984Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2223985Protein automated matches [191143] (10 species)
    not a true protein
  7. 2223990Species Maize (Zea mays) [TaxId:4577] [225479] (17 PDB entries)
  8. 2224002Domain d5hmra1: 5hmr A:40-246 [320097]
    Other proteins in same PDB: d5hmra2
    automated match to d4o95a1
    complexed with fad, fdz

Details for d5hmra1

PDB Entry: 5hmr (more details), 2 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor 3fmtdz
PDB Compounds: (A:) Cytokinin dehydrogenase 4

SCOPe Domain Sequences for d5hmra1:

Sequence, based on SEQRES records: (download)

>d5hmra1 d.145.1.0 (A:40-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
ggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarghg
hsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwtls
hgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcseten
pdlffgvlgglgqfgiitrarialera

Sequence, based on observed residues (ATOM records): (download)

>d5hmra1 d.145.1.0 (A:40-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
ggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarghg
hsisgqaqaaggvvvdmsrvaralpvhsaalgghyvdvwggelwvdvlnwtlshgglapr
swtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcsetenpdlffgv
lgglgqfgiitrarialera

SCOPe Domain Coordinates for d5hmra1:

Click to download the PDB-style file with coordinates for d5hmra1.
(The format of our PDB-style files is described here.)

Timeline for d5hmra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hmra2