SCOPe 2.07: Domain d5fuyc1: 5fuy C:204-338

Lineage for d5fuyc1 (5fuy C:204-338)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319946] (4 PDB entries)

8. Domain d5fuyc1: 5fuy C:204-338 [320095]
   Other proteins in same PDB: d5fuya2, d5fuyb2, d5fuyc2, d5fuyd2, d5fuye2, d5fuye3, d5fuyf2
   automated match to d1xbta1
   complexed with po4, qbt, zn

Details for d5fuyc1

PDB Entry: 5fuy, 2.8 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp

PDB Compounds: (C:) thymdine kinase

SCOPe Domain Sequences for d5fuyc1:

Sequence, based on SEQRES records:

>d5fuyc1 c.37.1.0 (C:204-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hgrieliigpmfagkttelmrrvqrhkhaqrscyiikytgdtrysegaitshdqraltan
vsvsnlhdvgdewrkydviavdegqffpdvaafcskaadsgkvvivsaldadylqepfee
icllvsradsvvkls

Sequence, based on observed residues (ATOM records):

>d5fuyc1 c.37.1.0 (C:204-338) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hgrieliigpmfagkttelmrrvqrhkhaqrscyiikytltanvsvsnlhdvgdewrkyd
viavdegqffpdvaafcskaadsgkvvivsaldadylqepfeeicllvsradsvvkls

Timeline for d5fuyc1:

• d5fuyc1 first appeared in SCOPe 2.06
  
• d5fuyc1 appears in the current release, SCOPe 2.08