Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [320091] (1 PDB entry) |
Domain d5kc9b_: 5kc9 B: [320092] automated match to d3qlud_ complexed with bu1, cl, edo, nag, pg4 |
PDB Entry: 5kc9 (more details), 2.3 Å
SCOPe Domain Sequences for d5kc9b_:
Sequence, based on SEQRES records: (download)
>d5kc9b_ c.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} siihigaifeenaakddrvfqlavsdlslnddilqsekitysikvieannpfqavqeacd lmtqgilalvtstgcasanalqsltdamhiphlfvqrnpggsprtachlnpspdgeaytl asrppvrlndvmlrlvtelrwqkfvmfydseydirglqsfldqasrlgldvslqkvdkni shvftslfttmkteelnryrdtlrrailllspqgahsfineavetnlaskdshwvfvnee isdpeildlvhsalgrmtvvrqifpsakdnqkcmrnnhrissllcdpqegylqmlqisnl ylydsvlmlanafhrkledrkwhsmaslncirkstkpwnggrsmldtikkghitgltgvm efredssnpyvqfeilgttysetfgkdmrklatwdsekglngs
>d5kc9b_ c.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} siihigaifeenaakddrvfqlavsdlslnsekitysikvieannpfqavqeacdlmtqg ilalvtstgcasanalqsltdamhiphlfvqrnpggsprtachlnpspdgeaytlasrpp vrlndvmlrlvtelrwqkfvmfydseydirglqsfldqasrlgldvslqkvdknishvft slfttmkteelnryrdtlrrailllspqgahsfineavetnlaskdshwvfvneeisdpe ildlvhsalgrmtvvrqifpsahrissllcdpqegylqmlqisnlylydsvlmlanafhr kledrkwhsmaslncirkstkpwnggrsmldtikkghitgltgvmefredssnpyvqfei lgtgkdmrklatwdsekglngs
Timeline for d5kc9b_: